Document ID: HKPW-ll-37-5-mg-research-peptide-usa-v1.0 | Reviewed: HKPEPTIDE WORLDWIDE Research Team | Updated: 2026-08-08
Product Identity & Specifications
| Parameter | Specification |
|---|---|
| Product | LL-37 (Cathelicidin Antimicrobial Peptide) |
| Dosage | 5 mg x 10 vials |
| CAS | 154947-66-7 |
| Formula | C205H340N60O53 |
| MW | ~4,493 Da |
| Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (37 aa) |
| Purity | ≥99% HPLC |
| Appearance | White to off-white lyophilized powder |
| Solubility | Sterile water or bacteriostatic water |
| Storage | 2–8°C, desiccated, protected from light |
| Class | Antimicrobial Host Defense Peptide |
Research Background
LL-37 is the only human cathelicidin — a family of antimicrobial peptides that serve as the first line of innate immune defense. The 37-amino acid peptide exhibits broad-spectrum antimicrobial activity against bacteria, viruses, and fungi. Beyond direct pathogen killing, LL-37 functions as a multifunctional immune modulator: it chemoattracts immune cells, promotes wound healing, neutralizes bacterial endotoxins (LPS), and modulates TLR signaling.
The 5 mg x 10 vials configuration is manufactured under strict quality control with HPLC, MS, and AAA verification. Batch-specific COA included. Bulk and OEM configurations available.
Molecular Mechanisms
Membrane Disruption
Amphipathic alpha-helical structure inserts into microbial membranes forming pores and causing lysis. Selective for bacterial anionic membranes over host zwitterionic membranes.
LPS Neutralization
High-affinity binding to bacterial lipopolysaccharide (LPS) prevents TLR4 activation and suppresses septic inflammatory cascades. This endotoxin-neutralizing activity is independent of antimicrobial action.
Immune Cell Chemotaxis
Formyl peptide receptor-like 1 (FPRL1) activation attracts neutrophils, monocytes, and T-cells to infection sites. Functions as an endogenous immune danger signal.
Wound Healing Promotion
Stimulates keratinocyte migration and proliferation for re-epithelialization. Promotes angiogenesis via VEGF upregulation in wound-edge endothelial cells.
Research Applications
- Antimicrobial Peptide Research
- Innate Immunity Studies
- Wound Healing and Inflammation
- LPS/TLR4 Signaling
- Host Defense Peptide Biology
Comparative Analysis
Compared to BPC-157: LL-37 targets innate immunity (antimicrobial plus immune modulation). BPC-157 targets tissue repair (angiogenesis plus cytoprotection). Compared to Thymosin Alpha-1: Both are immune-modulating peptides. LL-37 is a direct antimicrobial effector; Thymosin Alpha-1 primarily enhances T-cell function.
Quality Specifications
| Parameter | Method | Specification |
|---|---|---|
| Purity | HPLC 214nm C18 | ≥99.0% |
| Identity | ESI-MS | ~4,493 Da |
| Appearance | Visual | White to off-white powder |
| Peptide Content | AAA | ≥80% net peptide |
| Moisture | Karl Fischer | ≤3% |
| Endotoxin | LAL | ≤0.5 EU/mg |
Available Configurations
| Configuration | Content | Best For |
|---|---|---|
| Standard Kit | 5 mg x 10 vials × 10 vials | Evaluation |
| Bulk Kit | Custom × 10 vials | Chronic studies |
| OEM | Custom | Branded products |
FAQ
Q: What makes LL-37 unique?
LL-37 is the only human cathelicidin. It combines direct pathogen killing with immune modulation: it can kill bacteria AND simultaneously signal the immune system. This dual function distinguishes it from conventional antibiotics.
Q: How does LL-37 neutralize LPS?
LL-37 binds bacterial lipopolysaccharide (LPS) with high affinity, preventing LPS from activating TLR4 on immune cells. This endotoxin-neutralizing activity suppresses septic inflammatory cascades independently of LL-37 antimicrobial membrane disruption.
Wholesale Pricing
| Volume | Discount | For |
|---|---|---|
| 1 kit | List price | Evaluation; competitive analysis |
| 5+ kits | 10% off | Initial portfolio expansion |
| 20+ kits | 20% off | Mid-size distributors |
| 50+ kits | 30% off | Regional distributors |
Related Research & Resources
| Resource | Description |
|---|---|
| Healing Regenerative Peptides Hub | Complete research overview & methodology hub |
| Ll 37 5 Mg Cathelicidin Antimicrobial Pe | Related research peptide product |
| Ll 37 5 Mg Research Peptide Usa | Related research peptide product |
| Understanding Safety Discussions Around Peptides | Latest research insights & methodology |
View Complete Research Guide »
Compliance
FOR LABORATORY RESEARCH USE ONLY. Not for human or veterinary use. Not a dietary supplement or pharmaceutical.
© 2026 HKPEPTIDE WORLDWIDE. Document ID: HKPW-ll-37-5-mg-research-peptide-usa-v1.0